Home - Products - Others - Other Targets - 6-Hydroxykaempferol 3-O-beta-D-glucoside

6-Hydroxykaempferol 3-O-beta-D-glucoside

CAS No. 145134-61-8

6-Hydroxykaempferol 3-O-beta-D-glucoside( —— )

Catalog No. M31945 CAS No. 145134-61-8

6-Hydroxykaempferol 3-O-beta-D-glucoside has anti-thrombotic,and antioxidative activities.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
10MG 500 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    6-Hydroxykaempferol 3-O-beta-D-glucoside
  • Note
    Research use only, not for human use.
  • Brief Description
    6-Hydroxykaempferol 3-O-beta-D-glucoside has anti-thrombotic,and antioxidative activities.
  • Description
    6-Hydroxykaempferol 3-O-beta-D-glucoside has anti-thrombotic,and antioxidative activities.
  • In Vitro
    6-hydroxy kaempferol-3-oxo-β-glucosidase has good inhibition effect on cell proliferation of liver cancer and stomach cancer and can induce apoptosis of cancer cells, has low toxicity to normal cells, can be used to prepare drugs for resisting liver cancer and stomach cancer drugs or auxiliary chemotherapy drugs, can also be used as a food additive for the preparation of functional health food for cancer prevention.
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    145134-61-8
  • Formula Weight
    464.4
  • Molecular Formula
    C21H20O12
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • GSK-25

    GSK-25 maintains good selectivity against a panel of 31 kinases, as well as RSK1 and p70S6K (RSK1 IC50 of 398 nM, p70S6K IC50 of 1000nM), and a dramatically improved P450 profile (>2.2 uM at all isozymes tested).

  • Acetrizoic acid

    Acetrizoic acid is a molecule used as a contrast medium.

  • Exendin-4 peptide de...

    GTFTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.